Protein Info for Pf1N1B4_1745 in Pseudomonas fluorescens FW300-N1B4

Annotation: Biofilm PGA outer membrane secretin PgaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 826 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR03939: poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA" amino acids 17 to 826 (810 residues), 947.9 bits, see alignment E=2.4e-289 PF07719: TPR_2" amino acids 102 to 133 (32 residues), 23.9 bits, see alignment (E = 8e-09) PF13428: TPR_14" amino acids 102 to 141 (40 residues), 24.5 bits, see alignment 8e-09 PF13414: TPR_11" amino acids 108 to 144 (37 residues), 27.7 bits, see alignment (E = 4.3e-10) PF14559: TPR_19" amino acids 114 to 172 (59 residues), 37.5 bits, see alignment 6.3e-13 PF21197: PgaA_barrel" amino acids 526 to 826 (301 residues), 418.4 bits, see alignment E=3.5e-129

Best Hits

KEGG orthology group: K11935, biofilm PGA synthesis protein PgaA (inferred from 88% identity to pfo:Pfl01_0177)

Predicted SEED Role

"Biofilm PGA outer membrane secretin PgaA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162BKY1 at UniProt or InterPro

Protein Sequence (826 amino acids)

>Pf1N1B4_1745 Biofilm PGA outer membrane secretin PgaA (Pseudomonas fluorescens FW300-N1B4)
MPCIAGPFIHRGLRPLFRVALCGQLLWPVLAFADTPYDQMVRDARAGNYTPALAVLRQVP
VNQATTGQISDHLQIASWAGLDAEVVRVYETQGHNRALPVQALTATARAYRNLKRWDSAT
QVYNKALALDPKNADLQLGLAMTQADAGKPDEAVARAKALVAAKPDDPSRRLALAYALTR
AGATYDALFEYDQAFIRAGSKPDVAREYVIALQRARLPEPALRLARQRPGLLDPVTLRRL
EGDLAAERVRLAELATRSEKERYLIADRALADYDQLLTTWTPDTQAHDDVIRWRIDRMGA
LKARARTADVIAEYQKLLAEGVKIPTYALRWVASSYLDQRQPEIATDLYRQVLVAPDADV
GDRLEDSTALYYALLESDKADEARQVAEDLAKTQKPRVELKGLPVGNPNDEWMDAQQLAA
QAGTYGADLPSGEQRLQTLVDQAPGNLGLRLAQADLYLARDWPRRAENQLKETESMAPRD
IGLEVAQGHTAMDLQEWRQMDALTDDVVARFPGNRQVQRLQRQRAVHDMAELRVEAYGGK
SYGGGNGDAGAVNGSRDFGIETTLYSPPIDEDWRVFAGAGYATGDFQEGTGHHRFQRVGL
ERRTRDMTLEAEVSNHSYGFGDKQGARLAIARDIDDHWQYGGSLEYLSAQTPLRALNSDI
TANGGSGFIRWRANESREWRLAVSPSHFSDGNNRVEALLTGREGVYRAPGLQVDLGLEVG
TSHNSKSDDVPYFNPKSDFSVLPTVNVNHVLYHRYETSWSQQFQAGAGTYSQRDHGTGGV
GLLGYGQRYSWNDVFEVGGLLSVINRPYDGDRETDLRLLVDLTYRF