Protein Info for Pf1N1B4_1743 in Pseudomonas fluorescens FW300-N1B4

Annotation: Biofilm PGA synthesis N-glycosyltransferase PgaC (EC 2.4.-.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 5 to 27 (23 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 319 to 344 (26 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details amino acids 396 to 418 (23 residues), see Phobius details TIGR03937: poly-beta-1,6 N-acetyl-D-glucosamine synthase" amino acids 30 to 438 (409 residues), 643.1 bits, see alignment E=9.3e-198 PF13641: Glyco_tranf_2_3" amino acids 77 to 298 (222 residues), 120.6 bits, see alignment E=3e-38 PF00535: Glycos_transf_2" amino acids 78 to 245 (168 residues), 122.1 bits, see alignment E=7.1e-39 PF10111: Glyco_tranf_2_2" amino acids 78 to 172 (95 residues), 30.2 bits, see alignment E=9.8e-11 PF13506: Glyco_transf_21" amino acids 143 to 297 (155 residues), 45.7 bits, see alignment E=1.7e-15 PF03142: Chitin_synth_2" amino acids 143 to 257 (115 residues), 27.9 bits, see alignment E=3.1e-10 PF13632: Glyco_trans_2_3" amino acids 158 to 408 (251 residues), 86.4 bits, see alignment E=7.5e-28

Best Hits

KEGG orthology group: K11936, biofilm PGA synthesis N-glycosyltransferase PgaC [EC: 2.4.-.-] (inferred from 95% identity to pfo:Pfl01_0179)

Predicted SEED Role

"Biofilm PGA synthesis N-glycosyltransferase PgaC (EC 2.4.-.-)" (EC 2.4.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.-.-

Use Curated BLAST to search for 2.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z6J8 at UniProt or InterPro

Protein Sequence (451 amino acids)

>Pf1N1B4_1743 Biofilm PGA synthesis N-glycosyltransferase PgaC (EC 2.4.-.-) (Pseudomonas fluorescens FW300-N1B4)
MLDRLLALLVLAIVLGVPLGLIFLLTGQFLMDFVFFYPLFMSGLWIAGGLYFWLHWERHW
PWQDDTLPPALAGEPLISILIPCYNEGDNAADTIHAALAQHYPNIEVIAINDGSKDNTAA
VLDALAAQDPRLRVLHLAENQGKAVALRMGAIAARSEYLVCIDGDALLAPNTAAYLVAPM
LDNARLGAVTGNPRIRTRSTLIGRVQVGEFSSIIGLIKRTQRVFGRIFTVSGVIVAFRRT
ALNRVGYWSPDMITEDIDISWKLQLDHWSIFYEPRALCWILMPETLGGLWKQRLRWAQGG
AEVLFKNIRGIWQYRHRYLWPLLFEYCLSTGWAFTFLLSVIFWGVGKFIEMPSAIAVDHL
MPPAFTGLLLAVVCLVQFAVSILIDRRYEKGLGKTMFWVVWYPLVFWLISLLTTLVSFPK
VLFGQHQKRARWVSPDRGIKPLNDDEEEVIK