Protein Info for Pf1N1B4_1742 in Pseudomonas fluorescens FW300-N1B4

Annotation: Biofilm PGA synthesis auxiliary protein PgaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details TIGR03940: poly-beta-1,6-N-acetyl-D-glucosamine biosynthesis protein PgaD" amino acids 3 to 134 (132 residues), 75.5 bits, see alignment E=2e-25 PF13994: PgaD" amino acids 12 to 131 (120 residues), 71.2 bits, see alignment E=4.7e-24

Best Hits

KEGG orthology group: K11937, biofilm PGA synthesis protein PgaD (inferred from 77% identity to pfo:Pfl01_0180)

Predicted SEED Role

"Biofilm PGA synthesis auxiliary protein PgaD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NCZ6 at UniProt or InterPro

Protein Sequence (175 amino acids)

>Pf1N1B4_1742 Biofilm PGA synthesis auxiliary protein PgaD (Pseudomonas fluorescens FW300-N1B4)
MKIIRTRQRPFLVVIDVFLTVLAWVGLLYLLVRGLWPLVDTHDGPRIDASFFDALGTLQI
YLWVALLNAVILITWARYQQRKSKSFAQRRLPAPVVDDQGLSKSFKLTGDRLAKLRTPGS
MTIHNDQDGDVSHVVTHFFPVDPADLPPPLAPLEHSLVIRLSAEDDDNREPLSHV