Protein Info for Pf1N1B4_1694 in Pseudomonas fluorescens FW300-N1B4

Annotation: Cystine ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 109 (98 residues), 115.1 bits, see alignment E=9e-38 PF00528: BPD_transp_1" amino acids 32 to 215 (184 residues), 102 bits, see alignment E=1.7e-33

Best Hits

Swiss-Prot: 75% identical to YECS_ECOLI: L-cystine transport system permease protein YecS (yecS) from Escherichia coli (strain K12)

KEGG orthology group: K10009, cystine transport system permease protein (inferred from 95% identity to pfo:Pfl01_0243)

MetaCyc: 75% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Cystine ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NBS7 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Pf1N1B4_1694 Cystine ABC transporter, permease protein (Pseudomonas fluorescens FW300-N1B4)
MGEAFQLALDSAPFLLKGAYYTVILSLGGMFFGLLMGFGLALMRLSRFKLVSWIARIYVS
FFRGTPLLVQLFVIYYGLPQLGIELDPLPAALIGFSLNMAAYACEILRAAISSIERGQWE
AAASIGMTRAQTLRRAILPQAARTALPPLGNSFISLVKDTALAATIQVPELFRQAQLITA
RTFEIFTMYLAAALIYWVLATVLSHLQNQLEARVNRHDQES