Protein Info for Pf1N1B4_1687 in Pseudomonas fluorescens FW300-N1B4

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00106: adh_short" amino acids 7 to 192 (186 residues), 177.9 bits, see alignment E=3.4e-56 PF01370: Epimerase" amino acids 10 to 178 (169 residues), 26.4 bits, see alignment E=9.2e-10 PF08659: KR" amino acids 10 to 168 (159 residues), 61.4 bits, see alignment E=2.2e-20 PF13561: adh_short_C2" amino acids 13 to 245 (233 residues), 207.7 bits, see alignment E=4e-65

Best Hits

Swiss-Prot: 42% identical to AFLM_ASPPU: Versicolorin reductase 1 (aflM) from Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 82% identity to pba:PSEBR_a271)

MetaCyc: 42% identical to tetrahydroxy-7,9-dioxapentacycloicosaheptenone 16-reductase (Aspergillus parasiticus)
1.3.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NBL6 at UniProt or InterPro

Protein Sequence (246 amino acids)

>Pf1N1B4_1687 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Pseudomonas fluorescens FW300-N1B4)
MTAQTSKVAIVTGASRGIGAVIARQLASEGFAVAINYASSATEASKLVVELRQAGHQAIA
IKADVANADDVRRLFDETETQLGKVDVLVNNAGILKVLPLAQHSDELFDQNFNIHARGTF
NTLREAATRLNSGGRIINFSSSTVGMNLPGYAVYIASKAAVESLTQVFAKEMRGRNITVN
AVAPGPVATDLFLHGKSEEQIQNFAKMPPLERLGQPEDIARVVSFLVGPDSAWVNGQILR
VNGGLV