Protein Info for Pf1N1B4_1677 in Pseudomonas fluorescens FW300-N1B4

Annotation: Membrane fusion component of tripartite multidrug resistance system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details PF16576: HlyD_D23" amino acids 47 to 291 (245 residues), 65.3 bits, see alignment E=7.7e-22 PF13533: Biotin_lipoyl_2" amino acids 50 to 93 (44 residues), 41.1 bits, see alignment 1.7e-14 PF13437: HlyD_3" amino acids 215 to 307 (93 residues), 50.3 bits, see alignment E=5.3e-17

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 86% identity to pfo:Pfl01_0143)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NBE1 at UniProt or InterPro

Protein Sequence (354 amino acids)

>Pf1N1B4_1677 Membrane fusion component of tripartite multidrug resistance system (Pseudomonas fluorescens FW300-N1B4)
MTTQSKQKVAVGIAAAMALGVLIYLLAPGLFGKRTQQSTNDAFVSADYTRVAPRVAGFIK
DVLVEDNQLVKAGQLLALIDDRDLRAAAEAADAETLVARAQLQNARATLERQTSVIAQAQ
ATVVSAKAEMAFAEHELNRYNHLAGVGAGTVQNAQQARTRIDQASARLANATAVLAAERK
QVEILTAQRDAAEGGLKRAQAALEMASYELSYTRIVAPQDGMVGERAVRVGAYVTPGSKI
LAVVPLERAYVVANFQETQLTDVQPGQSVQVHVDSLGGEALRGRVESIAPATGVTFASVK
PDNATGNFTKVVQRIAVKILLDPGQPLAERLRVGMSVEARIDTASTGEHEVAQR