Protein Info for Pf1N1B4_1658 in Pseudomonas fluorescens FW300-N1B4

Annotation: Thioredoxin-like protein clustered with PA0057

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF01323: DSBA" amino acids 7 to 179 (173 residues), 35.5 bits, see alignment E=4.6e-13

Best Hits

KEGG orthology group: K07396, putative protein-disulfide isomerase (inferred from 79% identity to pfo:Pfl01_0294)

Predicted SEED Role

"Thioredoxin-like protein clustered with PA0057" in subsystem PA0057 cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NB11 at UniProt or InterPro

Protein Sequence (223 amino acids)

>Pf1N1B4_1658 Thioredoxin-like protein clustered with PA0057 (Pseudomonas fluorescens FW300-N1B4)
MILHYIYDPLCGWCYGAKPLVQAAQAVLPVIAHGGGMMTGANRQTVSPQLRNYVMPHDRR
IAEYTGQPFGEAYFEGLLRDETAVFDSAPPIAAVLAAEQIAGRGLALLGRLQTAHYVEGR
RIADNAVLLELATQTGLEPEAFQQAFNEADTERHIKDSRALLAKLGGQGFPTFAQEQDGQ
FTLVDIGPWLGKPQAFAQWLSQSLAAKESSSAFLACGLDGCAH