Protein Info for Pf1N1B4_1641 in Pseudomonas fluorescens FW300-N1B4

Annotation: Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00497: SBP_bac_3" amino acids 26 to 244 (219 residues), 208.3 bits, see alignment E=1e-65 PF10613: Lig_chan-Glu_bd" amino acids 69 to 118 (50 residues), 37.8 bits, see alignment 1.9e-13

Best Hits

Swiss-Prot: 39% identical to ARGT_SALTY: Lysine/arginine/ornithine-binding periplasmic protein (argT) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 93% identity to pfo:Pfl01_0311)

Predicted SEED Role

"Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166NAP9 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Pf1N1B4_1641 Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1) (Pseudomonas fluorescens FW300-N1B4)
MQNYKKIFLAAAVTLAFSAGAAAETLKMGIEAAYPPFNNKDASGNVVGFDKDIGDALCAK
MKVECTVVTSDWDGIIPALNAKKFDFLISSMSITDERKQAVDFTAPYYSNKLQFIAPKNV
DFKTDKASLQGKVIGAQRATLAGTWLEDNMEGVEIKLYDTQENAYLDLTSGRLDGILADK
YVNYEWLKSDAGRAYEFKGDPVEESDKIGIAVRKNDPIREKLDAALKEIVADGTYKKIND
KYFPFSIY