Protein Info for Pf1N1B4_1611 in Pseudomonas fluorescens FW300-N1B4

Annotation: Nitrogen regulation protein NR(I)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 104.6 bits, see alignment E=8.6e-34 TIGR01818: nitrogen regulation protein NR(I)" amino acids 7 to 463 (457 residues), 795 bits, see alignment E=1.1e-243 PF00158: Sigma54_activat" amino acids 141 to 308 (168 residues), 240.4 bits, see alignment E=2.2e-75 PF14532: Sigma54_activ_2" amino acids 142 to 312 (171 residues), 82.3 bits, see alignment E=1e-26 PF07728: AAA_5" amino acids 165 to 283 (119 residues), 30.7 bits, see alignment E=7.5e-11 PF02954: HTH_8" amino acids 423 to 463 (41 residues), 48.1 bits, see alignment 2e-16

Best Hits

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 100% identity to pfo:Pfl01_0339)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162AT09 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Pf1N1B4_1611 Nitrogen regulation protein NR(I) (Pseudomonas fluorescens FW300-N1B4)
MSRSETVWIVDDDRSIRWVLEKALQQEGMTTQSFDSADGVMSRLARQQPDVIISDIRMPG
ASGLDLLARIREQHPRLPVIIMTAHSDLDSAVASYQGGAFEYLPKPFDVDEAVSLVKRAN
QHAQEQQGLEVPVALTRTPEIIGEAPAMQEVFRAIGRLSHSNITVLINGESGTGKELVAH
ALHRHSPRAASPFIALNMAAIPKDLMESELFGHEKGAFTGAANLRRGRFEQADGGTLFLD
EIGDMPADTQTRLLRVLADGEFYRVGGHVPVKVDVRIIAATHQNLETLVHAGKFREDLFH
RLNVIRIHIPRLSDRREDIPTLAKHFLSRAAQELAVEPKLLKSETEEYLKNLPWPGNVRQ
LENTCRWITVMASGREVHISDLPPELLSLPQDSAPVTNWEQALRQWADQALARGQSSLLD
SAVPAFERIMIETALKHTAGRRRDAAVLLGWGRNTLTRKIKELGMKVDGGDDDEGDEG