Protein Info for Pf1N1B4_1565 in Pseudomonas fluorescens FW300-N1B4

Annotation: Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01502: PRA-CH
  • amino acids 30 to 104 (75 residues), 116.5 bits, E=2e-38

Best Hits

Swiss-Prot: 99% identical to HIS3_PSEPF: Phosphoribosyl-AMP cyclohydrolase (hisI) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01496, phosphoribosyl-AMP cyclohydrolase [EC: 3.5.4.19] (inferred from 99% identity to pfo:Pfl01_0384)

Predicted SEED Role

"Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19)" in subsystem Histidine Biosynthesis (EC 3.5.4.19)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.19

Sequence Analysis Tools

See A0A0C2A908 at UniProt or InterPro

Protein Sequence (133 amino acids)

>Pf1N1B4_1565 Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) (Pseudomonas fluorescens FW300-N1B4)
MKNWLDEIKWDADGLVPAIAQDHKTGRVLMMAWMNREALELTAAENRAIYWSRSRGKLWR
KGEESGHVQTLHEMRLDCDADVIILMVEQIGDIACHTGRQSCFYRVFENGDWKTVDPVLK
DPHAIYSAGHTHE