Protein Info for Pf1N1B4_1562 in Pseudomonas fluorescens FW300-N1B4

Annotation: Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01209: Ubie_methyltran
  • amino acids 25 to 255 (231 residues), 330.6 bits, E=1.8e-102
• TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase
  • amino acids 30 to 255 (226 residues), 280.6 bits, E=3.6e-88
• PF13489: Methyltransf_23
  • amino acids 52 to 237 (186 residues), 54.1 bits, E=6.5e-18
• PF01135: PCMT
  • amino acids 60 to 173 (114 residues), 32.2 bits, E=3.9e-11
• PF13847: Methyltransf_31
  • amino acids 68 to 233 (166 residues), 84.4 bits, E=2.8e-27
• PF13649: Methyltransf_25
  • amino acids 72 to 169 (98 residues), 83.9 bits, E=4.3e-27
• PF08241: Methyltransf_11
  • amino acids 73 to 173 (101 residues), 77.5 bits, E=4.2e-25
• PF08242: Methyltransf_12
  • amino acids 73 to 171 (99 residues), 53.8 bits, E=1.1e-17

Best Hits

Swiss-Prot: 98% identical to UBIE_PSEPF: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 98% identity to pfo:Pfl01_0387)

MetaCyc: 71% identical to bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinol methylase and demethylmenaquinone methyltransferase (Escherichia coli K-12 substr. MG1655)
2-OCTAPRENYL-METHOXY-BENZOQ-METH-RXN [EC: 2.1.1.201]; ADOMET-DMK-METHYLTRANSFER-RXN [EC: 2.1.1.201, 2.1.1.163]

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-)" in subsystem Menaquinone Biosynthesis via Futalosine or Menaquinone and Phylloquinone Biosynthesis or Ubiquinone Biosynthesis (EC 2.1.1.-)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
• menaquinol-4 biosynthesis I (1/1 steps found)
• menaquinol-6 biosynthesis (1/1 steps found)
• menaquinol-8 biosynthesis (1/1 steps found)
• menaquinol-9 biosynthesis (1/1 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (6/8 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• menaquinol-10 biosynthesis (1/2 steps found)
• menaquinol-11 biosynthesis (1/2 steps found)
• menaquinol-12 biosynthesis (1/2 steps found)
• menaquinol-13 biosynthesis (1/2 steps found)
• menaquinol-7 biosynthesis (1/2 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (4/9 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (3/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (3/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (4/11 steps found)
• superpathway of menaquinol-8 biosynthesis I (3/10 steps found)
• superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
• superpathway of menaquinol-10 biosynthesis (2/10 steps found)
• superpathway of menaquinol-11 biosynthesis (2/10 steps found)
• superpathway of menaquinol-12 biosynthesis (2/10 steps found)
• superpathway of menaquinol-13 biosynthesis (2/10 steps found)
• superpathway of menaquinol-6 biosynthesis (2/10 steps found)
• superpathway of menaquinol-7 biosynthesis (2/10 steps found)
• superpathway of menaquinol-8 biosynthesis II (2/10 steps found)
• superpathway of menaquinol-9 biosynthesis (2/10 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201

Sequence Analysis Tools

See A0A162BKJ7 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Pf1N1B4_1562 Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-) (Pseudomonas fluorescens FW300-N1B4)
MTDQRKGSDAEPTTHFGFKNVPESQKAEKVAEVFHSVAAKYDLMNDLLSGGMHRLWKRFA
IELSGVRTGNRVLDIAGGTGDLTRKFSHLVGPTGQVVLADINESMLKVGRDRLLDLGVSG
NVEFVQADAEKLPFPDNHFDCVTIAFGLRNVTHKEDALRSMLRVLKPGGRLLVLEFSKPT
NALMSKAYDAYSFAFMPLMGKLITNDSESYRYLAESIRMHPNQETLKSMMVEAGFDRVTY
HNMTAGIVALHRGIKP