Protein Info for Pf1N1B4_1552 in Pseudomonas fluorescens FW300-N1B4

Annotation: ATP-dependent protease HslV (EC 3.4.25.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03692: ATP-dependent protease HslVU, peptidase subunit
  • amino acids 2 to 171 (170 residues), 279.6 bits, E=4e-88
• PF00227: Proteasome
  • amino acids 2 to 169 (168 residues), 80.2 bits, E=8.2e-27

Best Hits

Swiss-Prot: 98% identical to HSLV_PSEF5: ATP-dependent protease subunit HslV (hslV) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 97% identity to pba:PSEBR_a413)

MetaCyc: 76% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Sequence Analysis Tools

See A0A0F4VFS9 at UniProt or InterPro

Protein Sequence (176 amino acids)

>Pf1N1B4_1552 ATP-dependent protease HslV (EC 3.4.25.-) (Pseudomonas fluorescens FW300-N1B4)
LTTIVSVRRHGKVVMGGDGQVSLGNTVMKGNAKKVRRLYHGQVIAGFAGATADAFTLFER
FEGQLEKHQGHLVRAAVELAKEWRTDRSLSRLEAMLAVANKDASLIITGNGDVVEPEEGL
IAMGSGGGYAQAAASALLKKTDLSAREIVETALGIAGDICVFTNHTFTIEEQDLAE