Protein Info for Pf1N1B4_1538 in Pseudomonas fluorescens FW300-N1B4

Annotation: Shikimate kinase I (EC 2.7.1.71)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 PF01202: SKI" amino acids 1 to 157 (157 residues), 191.1 bits, see alignment E=7e-61

Best Hits

Swiss-Prot: 98% identical to AROK_PSEF5: Shikimate kinase (aroK) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 98% identity to pba:PSEBR_a427)

MetaCyc: 52% identical to shikimate kinase 1 (Escherichia coli K-12 substr. MG1655)
Shikimate kinase. [EC: 2.7.1.71]

Predicted SEED Role

"Shikimate kinase I (EC 2.7.1.71)" in subsystem Benzoate transport and degradation cluster or Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.7.1.71)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.71

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z677 at UniProt or InterPro

Protein Sequence (163 amino acids)

>Pf1N1B4_1538 Shikimate kinase I (EC 2.7.1.71) (Pseudomonas fluorescens FW300-N1B4)
MGAGKSTIGRLLAKELRLPFKDSDKEIELRTGANIPWIFDKEGEPGFRDREQAMIAELCA
CDGVVLATGGGAVMREANRRALHAGGRVVYLHASVEQQVGRTARDRNRPLLRTADPAKTL
RDLLAIRDPLYREIADLVVETDERPPRMVVLDILERLQQLPPR