Protein Info for Pf1N1B4_1513 in Pseudomonas fluorescens FW300-N1B4

Annotation: FIG064705: cation/hydrogen antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 29 to 48 (20 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 282 to 310 (29 residues), see Phobius details amino acids 322 to 340 (19 residues), see Phobius details amino acids 346 to 366 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 86% identity to pba:PSEBR_a447)

Predicted SEED Role

"FIG064705: cation/hydrogen antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z152 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Pf1N1B4_1513 FIG064705: cation/hydrogen antiporter (Pseudomonas fluorescens FW300-N1B4)
MMVAVFWMMALVLFAVATRVGRHFGLIPIVSQLLLATFGLPLLMYFWIEPGWHLSGVDLI
SPGWLKNLYSLSFALLLGHILSDVIDLRLERQSLKIAVPSFCIPFACGLATAFWLLPPQP
WISSLAVGLLFAITAIPVLYLYLRHINYPPAATRRLVQTAILIDLTCWTLFAFAQGSLHL
SSLLLPLAGACLPLLLRLLGLRQPLLHSGCFFALLVVAEHFKLNALIFGIGYLLCMAALK
VPLVLPLSAAWMSRLQTWIAIPLILTFGIVQINVHSAMTSLGWVQLAALLLLPIASKLLG
NWLGLGWAGASFEGASRWRESLLLNIRGLSEIVFLNLLLQQQLISPALYFALMLMGLIAT
LLPALAGMHRIPLNIAAPARSTRANS