Protein Info for Pf1N1B4_1508 in Pseudomonas fluorescens FW300-N1B4

Annotation: Lysophospholipid acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 32 to 54 (23 residues), see Phobius details PF03279: Lip_A_acyltrans" amino acids 75 to 309 (235 residues), 52.1 bits, see alignment E=2.8e-18

Best Hits

KEGG orthology group: None (inferred from 88% identity to pfo:Pfl01_0434)

Predicted SEED Role

"Lysophospholipid acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162BKF9 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Pf1N1B4_1508 Lysophospholipid acyltransferase (Pseudomonas fluorescens FW300-N1B4)
MSDNADKQHWADRQERGSFWLMKFTALCAKVLGRRLLSPLLYGIVLYFFLFGRSARQSAW
QYQQRLADWSGRSELRPSHWRVFGQFMAFADSMLDKLDVWNGKLSIDQIEIIDPALLRNK
LRGTRGQMLVGAHLGNLEVCRALAEIGEKVTMNVLVHTKHAEQFNRLLGEAGATNLRLIQ
VSELDPVIMLQLHERLERGEWLAIAGDRVPLHGGRSVSVDFLGHQAAFPQGPWLLAGLLK
CPINLMLCLKKPTGDYRLTLEPFADAIVWKRSDREQVIHQWASRYAERLGHYCLEAPQQW
FNFYPFWKTDDDANA