Protein Info for Pf1N1B4_1491 in Pseudomonas fluorescens FW300-N1B4

Annotation: Methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 293 to 316 (24 residues), see Phobius details PF02743: dCache_1" amino acids 45 to 279 (235 residues), 72.1 bits, see alignment E=7.4e-24 PF00672: HAMP" amino acids 314 to 365 (52 residues), 52.5 bits, see alignment 7.7e-18 PF00015: MCPsignal" amino acids 453 to 613 (161 residues), 142.2 bits, see alignment E=2.3e-45

Best Hits

Swiss-Prot: 72% identical to MCPH_PSEPK: Methyl-accepting chemotaxis protein McpH (mcpH) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 91% identity to pfo:Pfl01_0450)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166N7Y2 at UniProt or InterPro

Protein Sequence (649 amino acids)

>Pf1N1B4_1491 Methyl-accepting chemotaxis protein (Pseudomonas fluorescens FW300-N1B4)
MQFWRRSIQWQLILSMGTALLVSILIVVGVYTLVVDRLAQRYLVEQALPSSIEAMRNDIE
RILVQPLTAAKDIASNSMVRDWLAGGESSAQTDTFVKYLEGLRAEHKAFTALIIGAASSH
YFTEKGLDRTLSRSNPNDAWFYSFLDSNQPRTLNIDNDTATGELALFIDLKVEQAGKVVG
VAGLGLSMKELSELIQNFNFGERGKVYLVRSDGLIQIHPEGQFSGKRTLVEQIGATAAQA
VMGQLSTSTAFATSSFVRDGEDFLALSLPLRDLGWTLVAEVPQSQIYAEARRAMWMSSGI
GLAVALVCLMLVVLLARGLVRPIRQVTAALVAIGSGGGDLTHRLDSSRADELGDLARGFN
RFLESQRDMIGEVLATSERLRTAVGQVARVVDNTAERSGRQQEMTDMVATAVHEMGLTVQ
EIAQNAGNAAVASQTARDEALQARVVVGGSIRHIESMSDEIGIAAGAVGELAHQVASIDQ
VLAVIRGISEQTNLLALNAAIEAARAGDMGRGFAVVADEVRTLARRTQSSTDEIQQMIGS
LKQGAENAVSSMHAGQAATGTGVESSQRTGASLTAITGQVERISDMNHQVATATEEQSAV
TEEINRNVQGISDLARATAGEVRACREDCQMLQRLADDLARQMGGFKLS