Protein Info for Pf1N1B4_1473 in Pseudomonas fluorescens FW300-N1B4

Annotation: ADP-heptose--lipooligosaccharide heptosyltransferase II (EC 2.4.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR02195: lipopolysaccharide heptosyltransferase II" amino acids 2 to 337 (336 residues), 540.2 bits, see alignment E=9.4e-167 PF01075: Glyco_transf_9" amino acids 69 to 318 (250 residues), 280.1 bits, see alignment E=7.3e-88

Best Hits

Swiss-Prot: 56% identical to RFAF_ECOLI: ADP-heptose--LPS heptosyltransferase 2 (rfaF) from Escherichia coli (strain K12)

KEGG orthology group: K02843, heptosyltransferase II [EC: 2.4.-.-] (inferred from 94% identity to pba:PSEBR_a485)

MetaCyc: 56% identical to ADP-heptose--LPS heptosyltransferase 2 (Escherichia coli K-12 substr. MG1655)
RXN0-5061 [EC: 2.4.99.24]

Predicted SEED Role

"ADP-heptose--lipooligosaccharide heptosyltransferase II (EC 2.4.1.-)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.-.-, 2.4.1.-

Use Curated BLAST to search for 2.4.-.- or 2.4.1.- or 2.4.99.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166N7E4 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Pf1N1B4_1473 ADP-heptose--lipooligosaccharide heptosyltransferase II (EC 2.4.1.-) (Pseudomonas fluorescens FW300-N1B4)
MKILIVGPSWVGDMVMAQTLFQCLKQRHPQCEIDVLAPEWSRPILERMPEVRQALSFPLG
HGVLELATRRRIGKSLAGQYDQAILLPNSLKSALVPFFAGIPKRTGWRGEFRYGLLNDVR
TLDKERYPLMIERFMALAIEPGVELPKPYPRPSLQIDPVTRDGALAKFGLALDRPVLALC
PGAEFGESKRWPSEHYAKVAEAKIREGWQVWLFGSKNDHAVGEDIRARLIPGLREESVNL
SGDTSLAEAIDLLSCADAVVSNDSGLMHVAAALNRPLVAVYGSTSPGFTPPLAEHVEIVR
LGIECSPCFDRTCRFGHYNCLRQLMPKAVNEALQRLLGTVVEVK