Protein Info for Pf1N1B4_1460 in Pseudomonas fluorescens FW300-N1B4

Annotation: Lipid A core - O-antigen ligase and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 64 to 80 (17 residues), see Phobius details amino acids 92 to 107 (16 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 206 to 221 (16 residues), see Phobius details amino acids 228 to 246 (19 residues), see Phobius details amino acids 302 to 324 (23 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 363 to 380 (18 residues), see Phobius details PF04932: Wzy_C" amino acids 195 to 314 (120 residues), 51.4 bits, see alignment E=5.4e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166N764 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Pf1N1B4_1460 Lipid A core - O-antigen ligase and related enzymes (Pseudomonas fluorescens FW300-N1B4)
MKKFFGKEVLEVWASIGFLVLLCGAWVLPDNKLYHQMMIFLLWLPALLALFHRDFRVMLK
QPECVLFVFFVAWTLLVLMVEGGNNILGKSKVTLYVALTLLGVLLAAQNRKWRLESMLLY
ASIMGGFFAAASWVYFYEVSAQPFSGRLIAIGLWDTAIMAAHAVGALLILGVFTLQTKRF
NPWLMVLVLIPALGYALFLGFSQTRGVWIGLLACLFVMGVARPSRLAGGLIILVVLGLAS
VAVFKPEILLQRGVSFRPELWSGGVQLMLDHWAMGLGFHEYLIPVPEIGQAFKHPHNLFL
DIGVRLGVPGLLLFGWLWLATGWRGWISRAQPLGQALLALWVFSGASLMTDGIGLWLKPN
ADWLITWLPIALSIVLAARGSNATKDFVWSVATPDARGPVAKC