Protein Info for Pf1N1B4_1417 in Pseudomonas fluorescens FW300-N1B4

Annotation: NAD(P)HX epimerase / NAD(P)HX dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 TIGR00197: YjeF family N-terminal domain" amino acids 12 to 210 (199 residues), 138 bits, see alignment E=3.2e-44 PF03853: YjeF_N" amino acids 34 to 192 (159 residues), 135.4 bits, see alignment E=1.9e-43 TIGR00196: YjeF family C-terminal domain" amino acids 234 to 491 (258 residues), 224.6 bits, see alignment E=1.6e-70 PF01256: Carb_kinase" amino acids 250 to 483 (234 residues), 205.8 bits, see alignment E=7.5e-65

Best Hits

KEGG orthology group: None (inferred from 83% identity to pfo:Pfl01_0518)

Predicted SEED Role

"NAD(P)HX epimerase / NAD(P)HX dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166N6D6 at UniProt or InterPro

Protein Sequence (499 amino acids)

>Pf1N1B4_1417 NAD(P)HX epimerase / NAD(P)HX dehydratase (Pseudomonas fluorescens FW300-N1B4)
MPHTKDELPDALYSAAQVRGLDASLIAAGTPGFELMQRAARATWRALVRHWPTAHELSVV
AGHGNNAGDGYLVAVLARRAGWHVRVLAAGDPGRLQGDAASAHAEAVTEGVAIQDWNAHS
ELRGIVLDALLGTGLTGEVREPYASVIAAINASGLPVAAVDIPSGLCADTGRQLGIAVRA
DLTVTFIGLKLGLFTGDAADVVGDLVFNDLLAAPETFIGATVSARRLTADNVPRLTGRAP
TAHKGKFGHVLLIGGDRGFGGAILLGAQSALRSGAGMVSVATRNEHVPAALARLPEAMVL
GTSSANQLMGLLEKVTVLVVGPGLGQAAWGRSLLSAAANAPLPQVWDADALNLLAEGGVS
LPAHCVITPHPGEAARLLGLSTAEVQADRPAAAHALSKKYTAVVVLKGAGSLVASPDGRL
ALCHQGHPAMASAGLGDVLAGLVGALLAQGMDAYDAACLAVWLHANAGEQQGKFGRGLAA
SDLIPAIRQLLEEQAPCLK