Protein Info for Pf1N1B4_1403 in Pseudomonas fluorescens FW300-N1B4

Annotation: 3'-to-5' exoribonuclease RNase R

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 876 TIGR02063: ribonuclease R" amino acids 23 to 748 (726 residues), 870.6 bits, see alignment E=8.9e-266 PF08461: HTH_12" amino acids 27 to 81 (55 residues), 27.5 bits, see alignment 6.2e-10 TIGR00358: VacB and RNase II family 3'-5' exoribonucleases" amino acids 78 to 747 (670 residues), 750.7 bits, see alignment E=1.3e-229 PF08206: OB_RNB" amino acids 91 to 148 (58 residues), 71.2 bits, see alignment 1.1e-23 PF17876: CSD2" amino acids 168 to 242 (75 residues), 80.4 bits, see alignment E=2.1e-26 PF00773: RNB" amino acids 264 to 602 (339 residues), 371.8 bits, see alignment E=8.6e-115 PF00575: S1" amino acids 663 to 747 (85 residues), 44.2 bits, see alignment E=5.2e-15

Best Hits

KEGG orthology group: K12573, ribonuclease R [EC: 3.1.-.-] (inferred from 96% identity to pfo:Pfl01_0532)

Predicted SEED Role

"3'-to-5' exoribonuclease RNase R" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166N618 at UniProt or InterPro

Protein Sequence (876 amino acids)

>Pf1N1B4_1403 3'-to-5' exoribonuclease RNase R (Pseudomonas fluorescens FW300-N1B4)
MADWQSLDPEAAREAEKYENPIPSRELILQHLADRGSPANREQLVEEFGLTTEDQIEALR
RRLRAMERDAQLIYTRRGTYAPVDKLDLILGRISGHRDGFGFLVPDDGSDDLFMSPAQMR
LVFDGDRALARVSGLDRRGRREGMIVEVVSRAHETIVGRYFEEGGIGFVVADNPKIQQEV
LVTPGRNANAQIGQFVEVKITHWPTPRFQPQGDVVEVVGNYMAPGMEIDVALRTYDIPHV
WPEAVLKEAAKLKPEVEEKDKEKRIDLRHLPFVTIDGEDARDFDDAVYCEAKPGKLRLFS
GGWKLYVAIADVSSYVKIGSALDNESQVRGNSVYFPERVVPMLPEQLSNGLCSLNPHVDR
LAMVCEMTISKSGEMTDYCFYEAVIHSHARLTYNKVSAMLETPKATEARQLRGEYTDVLP
HLKQLYALYKVLLAARHVRGAIDFETQETRIIFGSERKIAEIRPTVRNDAHKLIEECMLA
ANVATAEFLKKHEIPALYRVHDGPPPERLEKLRAFLGELGLSLHKGKDGPSPKDYQALLA
GIKDRPDFHLIQTVMLRSLSQAVYSADNQGHFGLNYEAYTHFTSPIRRYPDLLTHRAIRS
VIHSKMDTPHVRRAGAMTIPKARIYPYDEAILEQLGEQCSMSERRADEATRDVVNWLKCE
FMKDRVGESFPGVITAVTGFGLFVELTDIYVEGLVHVTALPGDYYHFDPVHHRLAGERTG
RSFRLGDTVEVRVMRVDLDERKIDFEMAEKTISAPIGRKKRGTETAAPAVKSAAEPAPAK
TGRRPAKEKVVEAYRPSDAAAKNAELRKSRELKQALLSEAKSGGKAASGGKTGRSAPDKA
SGGKPAKPSKHRKGPPKAGSAPAARSGGARKPKAKS