Protein Info for Pf1N1B4_139 in Pseudomonas fluorescens FW300-N1B4

Annotation: Pyoverdin biosynthesis protein PvdN, putative aminotransferase, class V

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 3 to 30 (28 residues), 17.7 bits, see alignment (E = 1.7e-07) PF00266: Aminotran_5" amino acids 96 to 416 (321 residues), 106.5 bits, see alignment E=7.6e-35

Best Hits

KEGG orthology group: None (inferred from 76% identity to pba:PSEBR_a3913)

MetaCyc: 63% identical to pyoverdin I decarboxylase monomer (Pseudomonas aeruginosa PAO1)
RXN-20772

Predicted SEED Role

"Pyoverdin biosynthesis protein PvdN, putative aminotransferase, class V" in subsystem Siderophore Pyoverdine

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MG57 at UniProt or InterPro

Protein Sequence (428 amino acids)

>Pf1N1B4_139 Pyoverdin biosynthesis protein PvdN, putative aminotransferase, class V (Pseudomonas fluorescens FW300-N1B4)
MNDRRTFLKQAGILAAGLPLGASLGSPAAAAQSQALPRDKWAQLRQLFDQDPNYIHFANF
LVTSHPKPVREAIARHRAALDLNPGLAMDWDLGVTHQREENVRLWAGRYLQAKPTQIALT
GSTTEGLAMIYGGVQVRPDQEILTTVHEHYSTNNILNFRNQRDGTRVRKIQLFEQPQSIS
ADQVLDTINRNIRPETRVLGMTWVHSGSGVKLPISDIGRLVDEHNRQRDDKDRIVYVVDG
VHGFGVEDLSFPAMNCDFFIAGTHKWMFGPRGTGIVCSRSEELKYVSPSVPTFSEATTFS
TIMSPGGYHAFEHRWAVDEAFKLHLELGKADVQARIHQLNSYLKQRLLEQPGIELVTPVD
PRFSAGFTFFRVKGQDCDAVAAHLVQNRIVSDAVSRDVGPVIRTAPGLLNTEAEVDRFID
VLGKKRSA