Protein Info for Pf1N1B4_1387 in Pseudomonas fluorescens FW300-N1B4

Annotation: NAD synthetase (EC 6.3.1.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 94% identical to NADE_PSEPF: NH(3)-dependent NAD(+) synthetase (nadE) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 94% identity to pfo:Pfl01_0547)

MetaCyc: 54% identical to NH3-dependent NAD+ synthetase (Escherichia coli K-12 substr. MG1655)
NAD(+) synthase. [EC: 6.3.1.5]

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

aspartate superpathway (21/25 steps found)
NAD de novo biosynthesis I (5/6 steps found)
NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
NAD salvage pathway II (PNC IV cycle) (4/5 steps found)
NAD salvage pathway I (PNC VI cycle) (5/7 steps found)
NAD de novo biosynthesis III (4/6 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z5V8 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Pf1N1B4_1387 NAD synthetase (EC 6.3.1.5) (Pseudomonas fluorescens FW300-N1B4)
MQAVQREIAEQLKVQPPFADQLALEAEVARRITFIQDCLVDSGLKTLVLGISGGVDSLTA
GLLAQRAMRELRERTGDSNYKFIAVRLPYETQFDEHDAQASVDFIAPDERHTVNIGPAVK
SLASEVAAFEGKHAVSVDFVLGNTKARMRMVAQYTIAGAAHGLVIGTDHAAEAVMGFFTK
FGDGACDLAPLSGLVKNQVRTIARSFGAPESLVEKIPTADLEDLSPGKPDEASHGVTYAE
IDAFLHGEPVREEAFKIICDTYKKTHHKRVMPFAP