Protein Info for Pf1N1B4_1377 in Pseudomonas fluorescens FW300-N1B4

Annotation: Mobile element protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF13518: HTH_28" amino acids 3 to 51 (49 residues), 37.2 bits, see alignment 8.4e-13 PF13011: LZ_Tnp_IS481" amino acids 10 to 60 (51 residues), 33.9 bits, see alignment 1.3e-11 PF13551: HTH_29" amino acids 13 to 61 (49 residues), 37.4 bits, see alignment 7.8e-13 PF13384: HTH_23" amino acids 13 to 44 (32 residues), 29.1 bits, see alignment (E = 2.4e-10) PF13565: HTH_32" amino acids 27 to 98 (72 residues), 48.2 bits, see alignment E=4.8e-16 PF00665: rve" amino acids 129 to 231 (103 residues), 38.9 bits, see alignment E=3.2e-13 PF13683: rve_3" amino acids 220 to 284 (65 residues), 60.4 bits, see alignment E=4e-20

Best Hits

KEGG orthology group: None (inferred from 55% identity to pfs:PFLU5832)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z5V1 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Pf1N1B4_1377 Mobile element protein (Pseudomonas fluorescens FW300-N1B4)
VKLVGDWMSGAYSKCELARHYGVSRPTLDKWLARYAERGIDGLKELSRRPHHSPHQISEH
VLELLIAYKREHPSWGPEKLVHNLKNTHAELSWPALSTAGEWLKRAGLVQKRRFLNRPPT
GPIPLREATEPNQTWAADFKGDFALQSGQRCFPLTISDHVSRFLLLCRAQSSVAGAREGF
DWAFREYGLPNVIRTDNGSPFASTGVSRISSLAAWFIRLGIYPERIQPGRPDQNGRHERM
HRTLKAALLQTPEHNLVQQQLAFERFRHEYNYERPHKALAMKVPADVYVPSSRLYDGRVP
EVNYPSQMLVRKVRQNGSMKWKGGMVFVSESLVGEALGLKEVEDEVWEVYLCNYLLGRLK
SGENRLSNPQKRKGCPRSRL