Protein Info for Pf1N1B4_1362 in Pseudomonas fluorescens FW300-N1B4

Annotation: Transcriptional regulator, AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF02311: AraC_binding" amino acids 18 to 98 (81 residues), 34.8 bits, see alignment E=1.9e-12 PF12833: HTH_18" amino acids 179 to 256 (78 residues), 90.2 bits, see alignment E=1.3e-29

Best Hits

KEGG orthology group: None (inferred from 84% identity to pfo:Pfl01_0573)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z0S5 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Pf1N1B4_1362 Transcriptional regulator, AraC family (Pseudomonas fluorescens FW300-N1B4)
MNSKHIDLLDFSELPAPVYFRYADFNTHEYASAHHHPWGTLEYSANGVLHMEIGSRRFMS
PPQYAVWVPPGTEHSFYSNQPINYRAVCLAPALCRDLPQQACTLAISDILKAILKDFAAR
DVKIPEHDADKRLAQVLVDQLQQAPKHECYLPYASSPGLLGILEALQAEPGDNRPLAHWA
AQIHVSERTLARQFVRELGMSFGEWRQRLRFLAAIEALDSQRSIQEIAFDMGYSTGSAFI
AMFQRQAGCTPEQYRRSHLDSR