Protein Info for Pf1N1B4_1350 in Pseudomonas fluorescens FW300-N1B4

Annotation: GCN5-related N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13420: Acetyltransf_4
  • amino acids 5 to 158 (154 residues), 49.1 bits, E=2e-16
• PF13302: Acetyltransf_3
  • amino acids 7 to 140 (134 residues), 41.9 bits, E=4.8e-14
• PF00583: Acetyltransf_1
  • amino acids 17 to 139 (123 residues), 62.5 bits, E=1.4e-20
• PF13673: Acetyltransf_10
  • amino acids 50 to 145 (96 residues), 28.1 bits, E=5.3e-10
• PF13508: Acetyltransf_7
  • amino acids 55 to 140 (86 residues), 31.8 bits, E=4.5e-11
• PF08445: FR47
  • amino acids 87 to 140 (54 residues), 25.3 bits, E=3.7e-09

Best Hits

Swiss-Prot: 73% identical to MDDA_PSEA7: L-methionine sulfoximine/L-methionine sulfone acetyltransferase (PSPA7_5587) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 86% identity to pfl:PFL_0634)

MetaCyc: 65% identical to L-amino acid N-acyltransferase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• phosalacine biosynthesis (4/25 steps found)
• phosphinothricin tripeptide biosynthesis (4/25 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1 or 2.3.1.183

Sequence Analysis Tools

See A0A166N535 at UniProt or InterPro

Protein Sequence (177 amino acids)

>Pf1N1B4_1350 GCN5-related N-acetyltransferase (Pseudomonas fluorescens FW300-N1B4)
MTYHIRDALLADLPAIRDIYNDAVLNTTAIWNEQAVDLGNRQAWFSARQTQGYPILVIVD
GDNSVLGYASFGDWRPFDGFRHTVEHSVYVRNDQRGNGLGPQLMEALIERAKGCGKHVMV
AAIESGNGASIRLHDRAGFVVTGQMPQVGTKFGRWLDLTFMQLILDPGAMPPGPHKE