Protein Info for Pf1N1B4_1339 in Pseudomonas fluorescens FW300-N1B4

Annotation: ABC transporter (iron.B12.siderophore.hemin) , ATP-binding component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF00005: ABC_tran" amino acids 86 to 235 (150 residues), 111 bits, see alignment E=7.4e-36

Best Hits

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 90% identity to pfo:Pfl01_0593)

Predicted SEED Role

"ABC transporter (iron.B12.siderophore.hemin) , ATP-binding component"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z0Q8 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Pf1N1B4_1339 ABC transporter (iron.B12.siderophore.hemin) , ATP-binding component (Pseudomonas fluorescens FW300-N1B4)
MTAGSGSSAIRDRFSSPLTAPFDPRASSRASPLPQESRNPCGSGLARDGAISNTENAKGT
RMTSLNLTNLAWTPLGHGHCHHQFQLRDASLHVAAGEFVGLIGPNGSGKTSLLRCAYRFS
KPERGEVKLDHYNVWKQSSRWCAQRIAVVLQEFPDAFGLSVDEVVVMGRTPHKGLFDGDT
LEDRKLAAHALESVGLKGFEDHAFATLSGGEKQRVILARALAQQPQLLILDEPTNHLDPR
YQLELLQLVKRLQIGTLASIHDLNLAAAFCDRLYVINHGRIVASGPPKEVLTAQLLHNVF
GVDALIDDHPLHGYPRITWITQP