Protein Info for Pf1N1B4_1331 in Pseudomonas fluorescens FW300-N1B4

Annotation: Cobalt-precorrin-6y C5-methyltransferase (EC 2.1.1.-) / Cobalt-precorrin-6y C15-methyltransferase [decarboxylating] (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00590: TP_methylase
  • amino acids 5 to 186 (182 residues), 62.3 bits, E=3.1e-21
• TIGR02467: precorrin-6y C5,15-methyltransferase (decarboxylating), CbiE subunit
  • amino acids 7 to 190 (184 residues), 155.4 bits, E=1.4e-49
• TIGR02469: precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit
  • amino acids 230 to 351 (122 residues), 114.9 bits, E=2.8e-37

Best Hits

Swiss-Prot: 71% identical to COBL_PSEAE: Precorrin-6Y C(5,15)-methyltransferase [decarboxylating] (cobL) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00595, precorrin-6Y C5,15-methyltransferase / precorrin-8W decarboxylase [EC: 1.-.-.- 2.1.1.132] (inferred from 89% identity to pfo:Pfl01_0603)

Predicted SEED Role

"Cobalt-precorrin-6y C5-methyltransferase (EC 2.1.1.-) / Cobalt-precorrin-6y C15-methyltransferase [decarboxylating] (EC 2.1.1.-)" in subsystem Coenzyme B12 biosynthesis (EC 2.1.1.-)

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (31/33 steps found)
• cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (13/13 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (13/15 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Nucleotide sugars metabolism
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 2.1.1.-

Use Curated BLAST to search for 1.-.-.- or 2.1.1.- or 2.1.1.132

Sequence Analysis Tools

See A0A166N4Q6 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Pf1N1B4_1331 Cobalt-precorrin-6y C5-methyltransferase (EC 2.1.1.-) / Cobalt-precorrin-6y C15-methyltransferase [decarboxylating] (EC 2.1.1.-) (Pseudomonas fluorescens FW300-N1B4)
MTPWLTVVGIGEDGFKGLGKNARRALMDASRIIGGQRQLDLLPVCIRGERQLWPSPFTLE
PLLALRGEPVCVLASGDPMFFGVGASLARQLPGAEMLILPAPSSVSLAAARLGWPLQDVV
TLSVVARPIAALNAHLFGGVRLLVLSNDGQTPAAIAALLRERGFGPSRLTVLEHLGGEAE
RRIEGVANDWNDPLIADLNLIAIECIAEPNTPRLSRLAGLPDSAFKHDGQLTKRDVRAIT
LARLAPIPGELLWDVGAGSGSIGIEWMRAHPSCRALAIEADEGRQLLIEHNRDALGVPGL
QLIRGSAPQALDGLERPDAVFIGGGVTREGVLDTCWAQLKPGGRLIANAVTLQSEVTLMA
WRERYGGELTRIHVAQAQPLGEFDTWRQALPITLLDVTKPLDA