Protein Info for Pf1N1B4_1329 in Pseudomonas fluorescens FW300-N1B4

Annotation: Cobalamin biosynthesis protein CobG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR02435: precorrin-3B synthase" amino acids 6 to 392 (387 residues), 401 bits, see alignment E=2.8e-124 PF03460: NIR_SIR_ferr" amino acids 24 to 80 (57 residues), 38.8 bits, see alignment 6.5e-14 amino acids 253 to 319 (67 residues), 64 bits, see alignment E=8.3e-22 PF01077: NIR_SIR" amino acids 90 to 231 (142 residues), 71.1 bits, see alignment E=7.3e-24

Best Hits

KEGG orthology group: K02229, precorrin-3B synthase [EC: 1.14.13.83] (inferred from 78% identity to pba:PSEBR_a616)

Predicted SEED Role

"Cobalamin biosynthesis protein CobG" in subsystem Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z0P9 at UniProt or InterPro

Protein Sequence (433 amino acids)

>Pf1N1B4_1329 Cobalamin biosynthesis protein CobG (Pseudomonas fluorescens FW300-N1B4)
MSTALRPSACPGLLRIVQALDGGICRIKLNGGSISASQAEAVASAAERFAGGVIEATNRA
NLQIRGIGSEQTALIDSLLAAGLGPRTAAGDDVRNLMLSPAAGIDRHRLFDTRPLAEQIL
ATLQSHERFHELSAKFAVQLDGGEALAMLEHPHDLWLSAAEREGERLLAFGLAGCPTDTP
AGSVTLEQGHALVVAVLELFLDLARPDQTRMRHVLAEIPVAEFLARLAERVPLNPITDWR
RSLSPDALHIGVHPQAGTEYVYIGAIPPLGRLDPVMLRGAAQLAREFGDGSLRFTPWQSL
LLPTVGKERAPEVIRRLEQLGLLCEPDQPLSRLIACTGSAGCGKGLADTKSDALQLAALL
QRHDQTVHLSGCQRSCAAAHGVPVTLLAVAPGRYDLYFRDAGQSGFGALHARNLTIEAVG
GLLDARPRSSLDA