Protein Info for Pf1N1B4_13 in Pseudomonas fluorescens FW300-N1B4

Annotation: SAM-dependent methyltransferase YafE (UbiE paralog)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF05175: MTS" amino acids 36 to 116 (81 residues), 24.8 bits, see alignment E=7e-09 PF03141: Methyltransf_29" amino acids 41 to 143 (103 residues), 33.4 bits, see alignment E=9.4e-12 PF01209: Ubie_methyltran" amino acids 42 to 158 (117 residues), 67.5 bits, see alignment E=5.4e-22 PF13489: Methyltransf_23" amino acids 42 to 192 (151 residues), 59.3 bits, see alignment E=1.8e-19 PF13847: Methyltransf_31" amino acids 46 to 149 (104 residues), 70.4 bits, see alignment E=6.5e-23 PF03848: TehB" amino acids 47 to 118 (72 residues), 21.8 bits, see alignment E=5e-08 PF13649: Methyltransf_25" amino acids 49 to 142 (94 residues), 85.9 bits, see alignment E=1.2e-27 PF08242: Methyltransf_12" amino acids 50 to 143 (94 residues), 57.9 bits, see alignment E=6.3e-19 PF08241: Methyltransf_11" amino acids 50 to 146 (97 residues), 93.2 bits, see alignment E=5.7e-30

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfo:Pfl01_1891)

Predicted SEED Role

"SAM-dependent methyltransferase YafE (UbiE paralog)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MDB0 at UniProt or InterPro

Protein Sequence (255 amino acids)

>Pf1N1B4_13 SAM-dependent methyltransferase YafE (UbiE paralog) (Pseudomonas fluorescens FW300-N1B4)
MTSTAQHSQVVQKQFGEQASAYLSSAVHAQGTEFALLQAELAGQGDARVLDLGCGAGHVS
FHVASLVKEVVAYDLSQQMLDVVAAAAVDRGLSNVSTVLGAAERLPFADGEFDFVFSRYS
AHHWSDLGLALREVRRVLKPGGVAAFIDVLSPGSPLFDTYLQSVEVLRDTSHVRDYSAGE
WLRQVSEAGLHTRSTTRQRLRLEYTSWVERMRTPQAMRAAIRELQQSMGNEVREYFEIEA
DGSFSTDVLVLMAER