Protein Info for Pf1N1B4_1276 in Pseudomonas fluorescens FW300-N1B4

Annotation: Flp pilus assembly protein RcpC/CpaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF16976: RcpC" amino acids 1 to 119 (119 residues), 77.8 bits, see alignment E=3.2e-26 TIGR03177: Flp pilus assembly protein CpaB" amino acids 1 to 184 (184 residues), 123 bits, see alignment E=6.5e-40

Best Hits

Predicted SEED Role

"Flp pilus assembly protein RcpC/CpaB" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (186 amino acids)

>Pf1N1B4_1276 Flp pilus assembly protein RcpC/CpaB (Pseudomonas fluorescens FW300-N1B4)
MIRPDERALAVAADDVVNVGGQLSPGDYVDVLLFLRMDTNNLQQSAQVVIPALRVLGVGD
QLGLMNDGLPAHPARSHEERLKQDQLRANARTVLLAVPEPLLSRLMLAAQVGVLRLAVRS
AEEKRLNQYWAGNRDSKASLASVNRELVQFSQLALVGTPKPATGGAAPRKSSVEVIRGNE
VTQQTH