Protein Info for Pf1N1B4_1081 in Pseudomonas fluorescens FW300-N1B4

Annotation: Ribosome hibernation protein YhbH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 TIGR00741: ribosomal subunit interface protein" amino acids 1 to 95 (95 residues), 117.5 bits, see alignment E=1.6e-38 PF02482: Ribosomal_S30AE" amino acids 3 to 92 (90 residues), 102.6 bits, see alignment E=7.8e-34

Best Hits

Swiss-Prot: 79% identical to HPF_PSEPU: Ribosome hibernation promoting factor (hpf) from Pseudomonas putida

KEGG orthology group: K05808, putative sigma-54 modulation protein (inferred from 100% identity to pba:PSEBR_a845)

Predicted SEED Role

"Ribosome hibernation protein YhbH" in subsystem Ribosome activity modulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0D0NJC8 at UniProt or InterPro

Protein Sequence (102 amino acids)

>Pf1N1B4_1081 Ribosome hibernation protein YhbH (Pseudomonas fluorescens FW300-N1B4)
MQVNISGHQLEVTEPLRTYIGEKLDRLERHFDKITNVQVTMNVEKLLQKIEATLHIPGGE
VVANAEHTDMYAAIDLLTDKLDRQLKKHKEKTQSLLQGATGR