Protein Info for Pf1N1B4_1061 in Pseudomonas fluorescens FW300-N1B4

Annotation: Outer membrane stress sensor protease DegS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00089: Trypsin" amino acids 105 to 264 (160 residues), 65.5 bits, see alignment E=1.6e-21 PF13365: Trypsin_2" amino acids 107 to 241 (135 residues), 116.5 bits, see alignment E=4.3e-37 PF00595: PDZ" amino acids 276 to 359 (84 residues), 39.1 bits, see alignment E=1.9e-13 PF13180: PDZ_2" amino acids 281 to 370 (90 residues), 59.1 bits, see alignment E=1.1e-19 PF17820: PDZ_6" amino acids 312 to 348 (37 residues), 34.7 bits, see alignment 3.2e-12

Best Hits

KEGG orthology group: K04691, serine protease DegS [EC: 3.4.21.-] (inferred from 96% identity to pba:PSEBR_a4728)

Predicted SEED Role

"Outer membrane stress sensor protease DegS" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166MZB8 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Pf1N1B4_1061 Outer membrane stress sensor protease DegS (Pseudomonas fluorescens FW300-N1B4)
MLKALRFSGWPLLAGVLIALLIMQRYPEWVGLPSLDVNLQQAPQTLGLQQGPVSYADAVT
TAAPSVVNLYTTKVVNKPSHPLFEDPQFRRFFGDNSPKQKRMESSLGSGVIMSPEGYLLT
NNHVTSGADQIVVALKDGRETLARVIGSDPETDLAVLKIDLKNLPSITVGRSDNIRIGDV
ALAIGNPFGVGQTVTMGIISATGRNQLGLNNYEDFIQTDAAINPGNSGGALVDANGNLTG
INTAIFSKSGGSQGIGFAIPVKLAMEVMKSIIEHGQVIRGWLGIEVQPLSQELAESFGLS
GRPGIVVAGIFRDGPAQKAGLQLGDVILSIDGEPAGDGRRSMNQVARIKPTDKVTIQVMR
NGKELKLTAEIGLRPPPAPIKEKEGE