Protein Info for PFLU_RS30920 in Pseudomonas fluorescens SBW25-INTG

Annotation: GNAT family acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF13673: Acetyltransf_10" amino acids 48 to 139 (92 residues), 52.2 bits, see alignment E=1.9e-17 amino acids 187 to 278 (92 residues), 37 bits, see alignment E=9.6e-13 PF13508: Acetyltransf_7" amino acids 56 to 130 (75 residues), 41.7 bits, see alignment E=3.7e-14 amino acids 196 to 277 (82 residues), 57.7 bits, see alignment E=3.8e-19 PF00583: Acetyltransf_1" amino acids 77 to 129 (53 residues), 31.5 bits, see alignment 5.5e-11 amino acids 170 to 277 (108 residues), 68.1 bits, see alignment E=2.6e-22 PF08445: FR47" amino acids 204 to 278 (75 residues), 29.2 bits, see alignment E=2.2e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3969)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JYW4 at UniProt or InterPro

Protein Sequence (297 amino acids)

>PFLU_RS30920 GNAT family acetyltransferase (Pseudomonas fluorescens SBW25-INTG)
MSTVVRIAQPADAEGISQVILAALHSSNARDYPADVIARVASNFTPDAVLALLERRVVLV
AIQDRMIVATAALDGSVVRSVFVNPVLQGQGIGRLLMIEIELRAREAGVTVLSVPSSLTA
EPFYAKLGFHTVRDVYHGNERTLVMEKALLSRHPIGPYRDRQHRAQVVALWQEAFGYETA
HNLPTLAIDKKLAVNDGLFFVATDKKTVIGTILAGYDGHRGWLYSVAVHADYRRHGLGSS
LVRHAEQALTALGCMKINLQITSGNEAVAGFYEALGYGVEPRISMGKKIVGNIPTRS