Protein Info for PFLU_RS29295 in Pseudomonas fluorescens SBW25-INTG

Annotation: YjbQ family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 TIGR00149: secondary thiamine-phosphate synthase enzyme" amino acids 5 to 139 (135 residues), 128.9 bits, see alignment E=4.9e-42 PF01894: UPF0047" amino acids 20 to 135 (116 residues), 120.1 bits, see alignment E=3e-39

Best Hits

Swiss-Prot: 59% identical to YJBQ_ECO57: UPF0047 protein YjbQ (yjbQ) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5951)

Predicted SEED Role

"FIG004064: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K441 at UniProt or InterPro

Protein Sequence (141 amino acids)

>PFLU_RS29295 YjbQ family protein (Pseudomonas fluorescens SBW25-INTG)
MWQQTLITLRAKPRGFHLVTDELLAGLPELRACRVGLLHLWLQHTSASLTVNENADPAVR
RDFERFFNSLVPQGLAGFEHNDEGPDDLPAHFKASLLGCQLSLPVKAGRLAMGTWQGVYL
GEHRDHGGARKVLATLHGDGA