Protein Info for PFLU_RS29030 in Pseudomonas fluorescens SBW25-INTG

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 660 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details amino acids 348 to 367 (20 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 9 to 330 (322 residues), 119.8 bits, see alignment E=1.4e-38 PF19040: SGNH" amino acids 404 to 646 (243 residues), 195 bits, see alignment E=1.9e-61

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5899)

Predicted SEED Role

"O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K3Y9 at UniProt or InterPro

Protein Sequence (660 amino acids)

>PFLU_RS29030 acyltransferase (Pseudomonas fluorescens SBW25-INTG)
MTVLAYRRDIDGLRAIAVLAVVLFHFGVPGVTGGFVGVDVFFVISGFLITSIIWRERQAG
RFSFVEFWARRARRILPALFVMMAATLVVGWFLLAPKDYEALGRSAHYQATFSSNLLFAR
QHGYFDAASDIKPLLHTWSLAVEEQFYIVFPLLLTLLSSRLKHWRLALLGVLLVSFGMSV
WAVTHQPQKAFYLLHLRAWELLAGAMLAVMPLRDWRAPPALAQGVSLVSLALILIAVFGF
DRHTPFPGAAALLPVLGVVGLIWANGQQHTWVGRLLSSRVMVGVGLISYSWYLWHWPVFV
YANYAAVDGLSPFELAGLMLVSLVLGYLSWRFVEAPFREKRLLAGRKAILAAGLAGILCL
GFTGLALREAKGVPWRLSEQALRYAQAKTWSPALMACMADKNTPDERLFCHFGPKNSSVS
ALVWGDSHATALIPALEDGAKRHDISLVQASFAGCMPLDGLENIARCAHFNQRVEKAMAE
QPFSDVVLVARWSLYLYGQMSGDKEHALKDPATGNYVRAVAEERFAQGLRERIKGLRAAG
HRVWLVKEVPLQEIIVPYRLSRLAMMHRPVDKEGLPVEEHMKRQAFITQLFDELAAADSG
VTVLDPAPLLCGADGLCRVELNGRALYTDDNHLSDVGARHIEAFLEPLFSSLQSRRLTAN