Protein Info for PFLU_RS28985 in Pseudomonas fluorescens SBW25-INTG

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 175 to 199 (25 residues), see Phobius details amino acids 211 to 240 (30 residues), see Phobius details amino acids 255 to 280 (26 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 25 to 363 (339 residues), 145.2 bits, see alignment E=4.2e-46 PF12679: ABC2_membrane_2" amino acids 138 to 368 (231 residues), 56.7 bits, see alignment E=3.7e-19 PF01061: ABC2_membrane" amino acids 179 to 336 (158 residues), 96.4 bits, see alignment E=2.7e-31

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to pfs:PFLU5890)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K3Y0 at UniProt or InterPro

Protein Sequence (372 amino acids)

>PFLU_RS28985 ABC transporter permease (Pseudomonas fluorescens SBW25-INTG)
MHTFAHILRLGIKELTSLRHDSVLLLFLFYAFTVAIYMPAAGSVIGVHNASVAFVDEDHS
SLSRQMAEALQPPEFQAPVPLPYDQLDKVMDSGEYTFVINVPANFQADLLAGRQPGVQVN
VDATAMSQAFMGAGYIGRIFQRELLTNSGQTDAAGQAPALLTTRALFNTNLEGGWFLAVI
QIVNNITILAIVLTGTALLREREHGTLDHLLVLPLTALEIMLAKIWSNMLVVVLCTWLSL
EVVVKGLLGVPLAGSLSLFLFVTALYLFASTALGIFLATLARSTPQFGLLAIPVIIPMLL
LSGGSTPLDSMPEWLQWIMQGSPSTHFVSLSAAILFRDAGVSVVWPDLLALAGIGLVFFA
VALARFRKSLAS