Protein Info for PFLU_RS28925 in Pseudomonas fluorescens SBW25-INTG
Annotation: extracellular solute-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 82% identical to P5217_PSEAE: Probable binding protein component of ABC iron transporter PA5217 (PA5217) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 100% identity to pfs:PFLU5876)Predicted SEED Role
"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See C3K3W7 at UniProt or InterPro
Protein Sequence (334 amino acids)
>PFLU_RS28925 extracellular solute-binding protein (Pseudomonas fluorescens SBW25-INTG) MLAPKRLLTALALTLIGSTTVQAADEVVVYSSRIDELIKPVFDAYTQKTGVQVKFITDKE APLMQRIKAEGENATADLLLTVDAGNLWQAEQMGILQPFTSAVIDKNIPLQYRSSKHAWT GLSLRARTIAYSTDRVKPGDLTTYEALADKQWEGRLCLRTAKKVYNQSLTATLIETHGAA KTEEIVKGWVNNLSTDVFSDDIAVLEAINAGQCDVGIVNTYYYGRLHKQKPDLAVKLFWP NQGDRGVHVNLSGIGLTKHAPHPEAAKALVEWMTTAEAQKIFADVNQEFPANPAVPPSAE VATWGKFVADTLPVEVAGKRQAEAIRLMDRAGWN