Protein Info for PFLU_RS28905 in Pseudomonas fluorescens SBW25-INTG

Annotation: DegT/DnrJ/EryC1/StrS aminotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01041: DegT_DnrJ_EryC1
  • amino acids 13 to 373 (361 residues), 361.9 bits, E=2.1e-112

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5872)

Predicted SEED Role

"UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (EC 2.6.1.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.6.1.-)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Arginine and proline metabolism
• Caprolactam degradation
• Lysine biosynthesis
• Lysine degradation
• Methionine metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.-

Sequence Analysis Tools

See C3K3W3 at UniProt or InterPro

Protein Sequence (379 amino acids)

>PFLU_RS28905 DegT/DnrJ/EryC1/StrS aminotransferase family protein (Pseudomonas fluorescens SBW25-INTG)
MSQQPFLPFSKPTIDEATISAVGDVLRSGWITSGPKVQAFEAQLSEYFGGRPVRTFNSGT
CTMEIALRIAGIGPGDEVITTPISWVATANVILEVGATPVFADIDPVTRNLDLVQVEAAI
TPRTKAIIPVYLAGLPLDMPMLYALANKYNLRIVEDAAQALGSSWDGERIGATGDFVSFS
FQANKNITSSEGGCLVLNNAEEARLAEKYRLQGVTRSGFDGLDVDVLGGKFNMTDIAAAI
GLGQFAHIEKITAHRQHLARHYFKCFGSDFEEQYGAQLPPADFENSNWHLFQLVLPERHD
GLPARATFMEQMQAHGVGIGYHYPPIHLLSLYRAQGFKEGMFPVAEKVGRLIVSLPMFTA
MTEADVERSVAAVKAVLQR