Protein Info for PFLU_RS28575 in Pseudomonas fluorescens SBW25-INTG

Annotation: GTPase/DUF3482 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 328 to 347 (20 residues), see Phobius details PF01926: MMR_HSR1" amino acids 7 to 152 (146 residues), 52 bits, see alignment E=7.3e-18 PF11981: DUF3482" amino acids 165 to 449 (285 residues), 380.2 bits, see alignment E=7.5e-118

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5805)

Predicted SEED Role

"probable integral membrane protein NMA1898"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K3P8 at UniProt or InterPro

Protein Sequence (452 amino acids)

>PFLU_RS28575 GTPase/DUF3482 domain-containing protein (Pseudomonas fluorescens SBW25-INTG)
MTKPLKLAVVGHTNVGKTSLLRTLTRDVGFGEVSHRPSTTRHVEGARLSVDGEALLELYD
TPGLEDAIALLDYLERLDRPGERLDGPARLARFLEGSEARQRFEQEAKVLRQLLASDAGL
YVIDAREPVLAKYRDELQVLASCGKPLLPVLNFVSSSDHREPDWREALARLGLHALVRFD
SVAPPEDGERRLYESLALLLENARPQLERLILDQQAQRQARQQSAARLIAELLIDCAACR
RSVLTEDEQQAIGDLRKAVRQREQKCVEALLKLFGFRPQDAAASDLPLLDGRWGDDLFNP
ETLKQLGVRVGGGIAAGAAAGAGVDLLVGGLTLGAAALAGAIAGGALQTARSYGSRLLGK
IKGQRELTVDDSVLRLLALRQRQLLKALNLRGHAAMHSIKVDTPQDKSWREGKLPDALHK
ARAHPQWSSLNPHAKLSQAERNEQIESLANAL