Protein Info for PFLU_RS28420 in Pseudomonas fluorescens SBW25-INTG

Annotation: thiazole synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF05690: ThiG" amino acids 12 to 258 (247 residues), 368.9 bits, see alignment E=5.8e-115

Best Hits

Swiss-Prot: 100% identical to THIG_PSEFS: Thiazole synthase (thiG) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 100% identity to pfs:PFLU5773)

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K3L7 at UniProt or InterPro

Protein Sequence (264 amino acids)

>PFLU_RS28420 thiazole synthase (Pseudomonas fluorescens SBW25-INTG)
MSIVRSDKPFVLAGRTYQSRLLVGTGKYRDMEETRLAIEASGAEIVTFAVRRTNLGQIEG
EPNLLEVLSPDRYTFLPNTAGCYDAIEAVRTCRLARELLDGHNLVKLEVLADQKTLFPNV
IETLKAAETLVKEGFDVMVYTSDDPIIARQLAEIGCIAVMPLAGLIGSGLGICNPYNLQI
ILEEAKIPVLVDAGVGTASDATIAMELGCDAVLMNSAIAHAQQPIMMAEAMNHAIVAGRL
AYLAGRMPKKLYASASSPLDGLIK