Protein Info for PFLU_RS28390 in Pseudomonas fluorescens SBW25-INTG

Annotation: methionine biosynthesis protein MetW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF07021: MetW" amino acids 2 to 194 (193 residues), 321.4 bits, see alignment E=5.6e-100 TIGR02081: methionine biosynthesis protein MetW" amino acids 2 to 195 (194 residues), 300 bits, see alignment E=3.3e-94 PF13489: Methyltransf_23" amino acids 11 to 101 (91 residues), 43.6 bits, see alignment E=7.7e-15 PF13847: Methyltransf_31" amino acids 15 to 104 (90 residues), 38.3 bits, see alignment E=3.5e-13 PF13649: Methyltransf_25" amino acids 18 to 102 (85 residues), 42.7 bits, see alignment E=2.2e-14 PF08242: Methyltransf_12" amino acids 19 to 101 (83 residues), 33.1 bits, see alignment E=2.3e-11 PF08241: Methyltransf_11" amino acids 19 to 104 (86 residues), 48.8 bits, see alignment E=2.8e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5767)

Predicted SEED Role

"Homoserine O-acetyltransferase (EC 2.3.1.31)" in subsystem Methionine Biosynthesis (EC 2.3.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.31

Use Curated BLAST to search for 2.3.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K3L1 at UniProt or InterPro

Protein Sequence (206 amino acids)

>PFLU_RS28390 methionine biosynthesis protein MetW (Pseudomonas fluorescens SBW25-INTG)
MRADLDIIQDWIPAGSRVLDLGCGDGELLSWLRDHKQVTGYGLENDPDNIAQCVAKGINV
IEQDLDKGLGNFASNSFDIVVMTQALQAVHYPDRILDEMLRVGRQCIITFPNFGHWRCRW
YLATKGRMPVSDFLPYTWYNTPNIHFCTFEDFEALCGEREAKVINRLAVDQQHRHGWASK
LWPNLLGEIGIYRVSSPGLTDHKIAV