Protein Info for PFLU_RS28305 in Pseudomonas fluorescens SBW25-INTG

Annotation: purine-binding chemotaxis protein CheW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF01584: CheW" amino acids 37 to 165 (129 residues), 103.9 bits, see alignment E=2.9e-34

Best Hits

Swiss-Prot: 64% identical to PILI_PSEAE: Protein PilI (pilI) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02659, twitching motility protein PilI (inferred from 100% identity to pfs:PFLU5750)

Predicted SEED Role

"type IV pili signal transduction protein PilI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K3J4 at UniProt or InterPro

Protein Sequence (174 amino acids)

>PFLU_RS28305 purine-binding chemotaxis protein CheW (Pseudomonas fluorescens SBW25-INTG)
MTESQTAFELLLDIDRRCRLLAADLPSQEARLQRWSGIGFRLGPHWYVAPMGEVAEVLHE
PRCTLMPGVKAWVKGVANLRGRLLPVMDLGGFLGLELSKARKQRRVLVVEFNDLFVGLLV
DEVVGMQHFAQDALLASAAPGVPFIQGQFEGDQQWQVFSPFALAQAPGFMDVAA