Protein Info for PFLU_RS27860 in Pseudomonas fluorescens SBW25-INTG

Annotation: glycine-betaine demethylase subunit GbcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF00970: FAD_binding_6" amino acids 25 to 116 (92 residues), 58.5 bits, see alignment E=1.1e-19 PF00175: NAD_binding_1" amino acids 129 to 234 (106 residues), 51 bits, see alignment E=3.1e-17 PF00111: Fer2" amino acids 289 to 359 (71 residues), 51.8 bits, see alignment E=9.5e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5659)

MetaCyc: 85% identical to glycine betaine monooxygenase ferredoxin reductase subunit (Pseudomonas aeruginosa)
RXN-22705 [EC: 1.14.13.251]

Predicted SEED Role

"GbcB Glycine betaine demethylase subunit B" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.251

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K3A6 at UniProt or InterPro

Protein Sequence (366 amino acids)

>PFLU_RS27860 glycine-betaine demethylase subunit GbcB (Pseudomonas fluorescens SBW25-INTG)
MSSNFLNPVTTQTWANGRHIVRCVKVIQETWDVRTFCFMADQPILFFFKPGQFVTLELEI
EGQPIMRSYTISSSPSVPYSFSVTIKRVPGGKVSNWLHDTLHEGQELAVHGPVGLFNAID
YPSPKVLYLSGGVGITPVMSMARWFYDTNANVDMTFIHSARSPKDIIYHRELEHMASRID
NFSLHLICEKHGLGEPWAGYRGYLNHKMLELMVPDFLEREVFCCGPTPYMNAVKRLLEVA
GFDMARYHEESFGATPPEARADAVEQAEQAADAPEIDLADLHQVEFIASGKSIRVAPGET
VHAAAAKLGLLIPKACGMGICGTCKVMKLGGEVEMDHNGGITEEDEAEGYILSCCSVPKG
DVRIEF