Protein Info for PFLU_RS27830 in Pseudomonas fluorescens SBW25-INTG

Annotation: conjugal transfer protein TraX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 101 to 117 (17 residues), see Phobius details amino acids 127 to 155 (29 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details PF05857: TraX" amino acids 16 to 238 (223 residues), 170.1 bits, see alignment E=3.4e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5653)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K3A1 at UniProt or InterPro

Protein Sequence (242 amino acids)

>PFLU_RS27830 conjugal transfer protein TraX (Pseudomonas fluorescens SBW25-INTG)
MHGTETMPVGRVRDGALDLLKWLALVSMVLDHLRYVGLSLDGLYVPGRLAFPWFCLAIAA
NLHRARNAPVTGQWRYLGWLLLFSVISEVPYRMFIDDADTLNVLPTLALGLLVARGWQQK
TLFDRGLAVIAVMIGAVFSTHLMFGFFGVLLPWAMLWVFRRPWYFSVLPGLLCVAANQWQ
ILLDSGTPVALMGLSACLLAPLLGLVLLRHTQNTSPPAMRRWAYALYPLHFLLLLLVRQI
IA