Protein Info for PFLU_RS27740 in Pseudomonas fluorescens SBW25-INTG

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 161 to 186 (26 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 21 to 127 (107 residues), 75.5 bits, see alignment E=2e-25 PF00528: BPD_transp_1" amino acids 41 to 232 (192 residues), 87 bits, see alignment E=6.9e-29

Best Hits

Swiss-Prot: 37% identical to NOCM_AGRFC: Nopaline transport system permease protein NocM (nocM) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to pfs:PFLU5635)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K383 at UniProt or InterPro

Protein Sequence (236 amino acids)

>PFLU_RS27740 ABC transporter permease subunit (Pseudomonas fluorescens SBW25-INTG)
MNIENLLSALLNVALLERYAPRFIDGLLVTGKLVAISFSLGALLGLLIALGRLSTYRWVR
GFTGVYVYFFRGSPLLVQLFMLYYGLGSFKGFWQEVGLWWFFRDAWLCTLLAFTLNTAAY
QAEIMRGALTAIAPGQREASQTLGLSRWTTLRKVILPQSLLVAIGPLGNELVLMIKASSI
ASLVTIYDLMGVTKLAFSRTFDFQIYLWAAVLYLVIVEVVRRALKRLERSLSKHIG