Protein Info for PFLU_RS27650 in Pseudomonas fluorescens SBW25-INTG

Annotation: biotin synthase BioB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 TIGR00433: biotin synthase" amino acids 21 to 316 (296 residues), 404.8 bits, see alignment E=1.1e-125 PF04055: Radical_SAM" amino acids 54 to 211 (158 residues), 75.8 bits, see alignment E=4.9e-25 PF06968: BATS" amino acids 226 to 316 (91 residues), 102.1 bits, see alignment E=1.5e-33

Best Hits

Swiss-Prot: 97% identical to BIOB_PSEPF: Biotin synthase (bioB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 100% identity to pfs:PFLU5615)

MetaCyc: 68% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K364 at UniProt or InterPro

Protein Sequence (351 amino acids)

>PFLU_RS27650 biotin synthase BioB (Pseudomonas fluorescens SBW25-INTG)
MSASTTATLRHDWSLAEVKALFVQPFNDLLFQAQTVHRAHFDANRVQVSTLLSIKTGACP
EDCKYCPQSGHYNTGLEKEKLMEVQKVLEEAARAKAIGSTRFCMGAAWKHPSAKDMPYVL
QMVKGVKAMGLETCMTLGRLDQDQTEALAQAGLDYYNHNLDTSPEFYGSIITTRTYGERL
QTLAYVRDSGMKICSGGILGMGESLDDRANLLIQLANLPEHPESVPINMLVKVAGTPLEN
AEDIDPFDFIRMLAVARILMPRSHVRLSAGREAMNEQMQALAFFAGANSIFYGDKLLTTA
NPQADKDMQLFSRLGILPEAREEHADEVHQAAIEQALVEQKSSEQFYNAAV