Protein Info for PFLU_RS27635 in Pseudomonas fluorescens SBW25-INTG

Annotation: malonyl-ACP O-methyltransferase BioC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF01209: Ubie_methyltran" amino acids 18 to 154 (137 residues), 37.1 bits, see alignment E=8.2e-13 TIGR02072: malonyl-acyl carrier protein O-methyltransferase BioC" amino acids 22 to 268 (247 residues), 253.8 bits, see alignment E=1e-79 PF13489: Methyltransf_23" amino acids 43 to 198 (156 residues), 47.3 bits, see alignment E=6.6e-16 PF01728: FtsJ" amino acids 55 to 111 (57 residues), 24.5 bits, see alignment E=8.4e-09 PF13847: Methyltransf_31" amino acids 56 to 168 (113 residues), 52.8 bits, see alignment E=1.3e-17 PF13649: Methyltransf_25" amino acids 58 to 147 (90 residues), 68.6 bits, see alignment E=2.2e-22 PF08242: Methyltransf_12" amino acids 58 to 149 (92 residues), 43.8 bits, see alignment E=1.3e-14 PF08241: Methyltransf_11" amino acids 58 to 151 (94 residues), 77 bits, see alignment E=5e-25

Best Hits

Swiss-Prot: 71% identical to BIOC_PSEA7: Malonyl-[acyl-carrier protein] O-methyltransferase (bioC) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 100% identity to pfs:PFLU5612)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K361 at UniProt or InterPro

Protein Sequence (270 amino acids)

>PFLU_RS27635 malonyl-ACP O-methyltransferase BioC (Pseudomonas fluorescens SBW25-INTG)
MTDLSHAPLPGALPDKRQVAASFSRAAASYDSVAELQRAVGSQLLARLPGGTAPQRWLDM
GCGTGYFSRMLAERLPASQGIALDIAEGMLNHARPLGGAHHFIAGDAERLPLKAESLGLI
FSSLAVQWCANFEAVLSEAYRVLQPGGVLAFASLCVGTLEELRESWRAADGLVHVNRFRT
FEAYQQLCAASGLRLVSLERRPHVLHYPDVRSLTHELKALGAHNLNPGRPGGLTGRARIV
ALVQAYERFRQAQGLPATYQVVYAVLEKPL