Protein Info for PFLU_RS27300 in Pseudomonas fluorescens SBW25-INTG

Annotation: peptidoglycan DD-metalloendopeptidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details PF04225: OapA" amino acids 109 to 186 (78 residues), 33.3 bits, see alignment E=6.4e-12 PF19425: Csd3_N2" amino acids 200 to 320 (121 residues), 51.1 bits, see alignment E=2e-17 PF01551: Peptidase_M23" amino acids 333 to 429 (97 residues), 120 bits, see alignment E=6.4e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU5545)

Predicted SEED Role

"Cell wall endopeptidase, family M23/M37"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K2Z4 at UniProt or InterPro

Protein Sequence (472 amino acids)

>PFLU_RS27300 peptidoglycan DD-metalloendopeptidase family protein (Pseudomonas fluorescens SBW25-INTG)
MTTEPSKAPPLYPKTHLLAASGIAALLSLALLVFPSSEVEAKRTSLSLDLESPVEQLTQD
QDASDAQQATNAQVDSPFAQIENSPEDTQQAAQTKAALTVDTAKNPQHREVIVGKGDTLS
TLFEKVGLPAATVNEVLASDKQAKQFTQLKRGQKLEFELTPDGQLNNLHSNVSDLESITL
TKGAKGFAFNRVTTKPVMRSAYVHGVINSSLSQSAARAGLSHSMTMDMASVFGYDIDFAQ
DIRQGDEFDVIYEQKVANGKVVGTGNILSARFTNRGKTYTAVRYTNKQGNSSYYTADGNS
MRKAFIRTPVDFARISSRFSMGRKHPILNKIRAHKGVDYAAPRGTPIKAAGDGKVLLAGR
RGGYGNTVIIQHGNTYRTLYGHMQGFAKGVQTGGTVKQGQVIGYIGTTGLSTGPHLHYEF
QVNGVHVDPLGQKLPMADPIAKAERARFMQQSQPLMARMDQERSTLLASAKR