Protein Info for PFLU_RS26570 in Pseudomonas fluorescens SBW25-INTG

Annotation: HlyC/CorC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF00571: CBS" amino acids 63 to 120 (58 residues), 21 bits, see alignment E=3.5e-08 amino acids 131 to 184 (54 residues), 29.2 bits, see alignment E=9.6e-11 PF03471: CorC_HlyC" amino acids 203 to 276 (74 residues), 73 bits, see alignment E=1.5e-24

Best Hits

Swiss-Prot: 52% identical to CORC_VIBCH: Magnesium and cobalt efflux protein CorC (corC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K06189, magnesium and cobalt transporter (inferred from 100% identity to pfs:PFLU5407)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K2K9 at UniProt or InterPro

Protein Sequence (279 amino acids)

>PFLU_RS26570 HlyC/CorC family transporter (Pseudomonas fluorescens SBW25-INTG)
MSEDRSSNGQKSWLGKLTQAFAHEPKNRQELLELLREAHQNKLLDSEALAIVEGAIQVAD
LQVRDIMVPRSQMISIKATQTPREFLPAVIDSAHSRYPVIGESHDDVMGVLLAKDLLPLI
LKENGDSFNIKDLLRPATFVPESKRLNVLLREFRANHNHMAIVIDEYGGVAGLVTIEDVL
EQIVGDIEDEHDVEEDSYIKPLPSGDFLIKALTPIENFNEFFDSEFSDDEFDTVGGLVMS
AFGHLPKRNETTEIGAYRFRILNADSRRIHLIRLTPIAR