Protein Info for PFLU_RS26360 in Pseudomonas fluorescens SBW25-INTG

Annotation: shikimate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08501: Shikimate_dh_N
  • amino acids 9 to 96 (88 residues), 71.7 bits, E=2.5e-24

Best Hits

Swiss-Prot: 57% identical to AROE_STRAW: Shikimate dehydrogenase (NADP(+)) (aroE) from Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 100% identity to pfs:PFLU5365)

Predicted SEED Role

"Quinate/shikimate 5-dehydrogenase I delta (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

See C3K2G7 at UniProt or InterPro

Protein Sequence (282 amino acids)

>PFLU_RS26360 shikimate dehydrogenase (Pseudomonas fluorescens SBW25-INTG)
MKPRILAGLIGSGIQASRTPALHEQEGDAQGLRYLYRLIDLEPLRLDINALPDLLEAAEL
MHFTGLNITYPCKQAILPLLDELSDEARGIGAVNTVVFKDGKRIGHNTDCLGFAEGFRRN
LNDVARQRVVQMGAGGAGAAVAHALLAEGVEHLSIFDVDASRARDLVDNLAQRFGTGRAQ
VGTHLENAMAEADGLVNTTPMGMAKLPGTPVPASLLRAELWVAEIVYFPLETQLLRDARV
LGCRTLDGGNMAVFQAVKAFELFSGEAPDAQRMLLHFQSMNT